PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00570.1_g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 271aa    MW: 30830.7 Da    PI: 7.6872
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00570.1_g00010.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.56.5e-083176346
                             SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                              WT+eE +++ +a + +  +   +W ++a++++ g+t  ++   + k
  Rsa1.0_00570.1_g00010.1 31 TWTKEENKKFERALAIYADDtpdRWFKVAAMIP-GKTISDVMTQYSK 76
                             7*****************99*************.****999888866 PP

2Myb_DNA-binding409e-13131175347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              +WT+eE+ +++ +  ++G+g+W+ I+r +   +t+ q+ s+ qky
  Rsa1.0_00570.1_g00010.1 131 PWTEEEHRRFLLGLLKYGKGDWRNISRNFVGSKTPTQVASHAQKY 175
                              8****************************999************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.1212780IPR017884SANT domain
SMARTSM007171.7E-72880IPR001005SANT/Myb domain
PfamPF002498.7E-73076IPR001005SANT/Myb domain
SuperFamilySSF466891.15E-103084IPR009057Homeodomain-like
CDDcd001672.54E-73177No hitNo description
PROSITE profilePS5129418.108124180IPR017930Myb domain
SuperFamilySSF466891.08E-15126179IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.1E-11128180IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-16128179IPR006447Myb domain, plants
SMARTSM007179.9E-11128178IPR001005SANT/Myb domain
PfamPF002493.9E-10131175IPR001005SANT/Myb domain
CDDcd001676.83E-10131175No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
METLHPLLLS HVPTSDHRFV VQEMMCLQTS TWTKEENKKF ERALAIYADD TPDRWFKVAA  60
MIPGKTISDV MTQYSKLEED LFDIEAGLVP IPGYPSAGFD HLVSPHDFDL YRKRPNGGAR  120
GFDQDRRKGV PWTEEEHRRF LLGLLKYGKG DWRNISRNFV GSKTPTQVAS HAQKYYQRQL  180
SGAKDKRRPS IHDITTVNLL NNNITRTSSD HDRFLQQPDE PKLGFTDRGN AEDGVMFLGQ  240
NLSSVLSPYE PAFKFTGTNV YGDGACCLTR S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A6e-1632981177RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00489DAPTransfer from AT5G05790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009122177.10.0PREDICTED: transcription factor DIVARICATA
RefseqXP_013715256.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H72e-72DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLM4CY370.0M4CY37_BRARP; Uncharacterized protein
STRINGBra009134.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM43402657
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05790.11e-163MYB family protein